SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068RPW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068RPW7
Domain Number 1 Region: 170-282
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-23
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068RPW7
Sequence length 434
Comment (tr|A0A068RPW7|A0A068RPW7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDH51667.1} KW=Complete proteome; Reference proteome OX=1263082 OS=Lichtheimia corymbifera JMRC:FSU:9682. GN=LCOR_03241.1 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MATTHHEQDDLSSTGPFTSKPLIEQRRGSLAHMFLTTTSSLQQSAAQEALEDPMDQDWPP
PPHPPPLESPSMHGGSSIPFGRRRSSSCNMLTTPSIVGGAASKGHGGVDRLLNVHTLYKI
KRRKFHLFGSQQQKHDLPPAAAPILSSSFSSPLLEDVSIAEIRREGVKGMLQSKIPICYF
LYHLLQEISSENLFFFTEIEQYESFTYMTLVQQLATAQHIYDTYLSPNSHFEVNIDERIR
HAVQHALQEKQVQGCFDPAKQAVYALLESSFMRFIDTPIWYEMVKQCGNIIGEETMCHNE
ETKHAAVNTLLRYIEQQHAMLYTNPHMDAPLSMCMQTAKKRHDLTKSMVHEFCLTVVGVE
FQYYNIWSTRQDEHEDHLEYHHRQSSSSSSFMTPSSSMSSLSSHSRSGSSQLIQALKRPR
QVVEAFDFFAKKKK
Download sequence
Identical sequences A0A068RPW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]