SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XGB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XGB0
Domain Number 1 Region: 111-242
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.46e-41
Family Regulator of G-protein signaling, RGS 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XGB0
Sequence length 288
Comment (tr|A0A068XGB0|A0A068XGB0_HYMMI) Regulator of G protein signaling 4 {ECO:0000313|EMBL:CDS31207.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000339900 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MGDKSQSSSETSEINPSTTTIASDSESQGKGPAPGELTILRGSQGKNQLSNNSAFFALQN
TVRNCIPVVLPPRKNPWDVVLEPLVPFKGLQRVSSDENIAASFRVKKVHLKKVTAEQIRR
WETNFGFLLNDPDGLALFEKFLESEFSQENIQFWEACEKYRRLPAKYLAQEAQKIYQLYL
SVQSPREVNLDSKTRLSTISLLSTPTVHLFDNAQRKIQALMEKDSYQRFLRVPLFLDFKK
SVIDEPSCPPTKSRTSPQHKKKPPATTIQSALPSVINITTLPLGRKPF
Download sequence
Identical sequences A0A068XGB0
HmN_000339900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]