SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y1A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y1A7
Domain Number 1 Region: 116-171
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000024
Family SH3-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068Y1A7
Sequence length 175
Comment (tr|A0A068Y1A7|A0A068Y1A7_ECHMU) Uncharacterized protein {ECO:0000313|EMBL:CDS36884.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000411400 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MRPKPAVAPSPFHKPPDGDAPPLHREEHELSAKTFVWLMVENIPPTHQTQSLGFKNNDIV
RWLDFDPKHLGSKPSPLPAGRFLDCETWSGQLVVVPSEYARPISSTLELAQVLQRMPRAR
VIKDFVGTGDDDLSVGAGEVIYLLFECDSTYFMAMNKGLTRGRVPKSVLNVLVAP
Download sequence
Identical sequences A0A068Y1A7
EmuJ_000411400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]