SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y9M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y9M4
Domain Number 1 Region: 238-509
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-70
Family Protein kinases, catalytic subunit 0.00000489
Further Details:      
 
Domain Number 2 Region: 104-269
Classification Level Classification E-value
Superfamily SH2 domain 7.62e-21
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 3 Region: 53-128
Classification Level Classification E-value
Superfamily SH3-domain 2.4e-17
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068Y9M4
Sequence length 525
Comment (tr|A0A068Y9M4|A0A068Y9M4_ECHMU) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN= OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MGEAYVVYQAKEEEEEEEEEEEEEEKGRRAKRNPRPNPSPTEPIAVPNPCKPPSPQHTQP
EKQSDGYAKPTKPSTVQAIYDFVATQPDECSFTMGDLLTVVDDTDDWWLATNLRTQEKGF
IPPNYVTSDMSLSNVLEAWYDVDRMGAERKLLMPGVQSGTYIIRPCTYPGSPYCLSVRGN
GVRIRHYRVYYSESTGKFYISEATPFCSLDELISHYYSYPVDGEVGLIEARRRIVPPPLS
FKDCFISYTDVQLGEELGRGNFGVVYRGHILSMEVAVKKSLDLTNDAAFREEAKVMHKLS
HQRIVRFLGFCCDAPDGRVLIITEFMPNGALRDYLQKADRQFLDYRQLISIIDQVVKGMV
YLEKVGVVHRDLRARNVLVDQDVSVKIADFGLTRIHDYDQNFTGSAFPVSWTAPEAMRSG
YEPNSKADVWSFGVLMFEVLTYGETPYKGLTREQVQDFVLGGGRLPSPSSKGFECEEAVD
NIMESCWKEQPEQRLSFSELSHEIEKYIIAKEGKYDASWYKMTDN
Download sequence
Identical sequences A0A068Y9M4
EmuJ_000642200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]