SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YC89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YC89
Domain Number 1 Region: 799-913
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000411
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068YC89
Sequence length 932
Comment (tr|A0A068YC89|A0A068YC89_ECHMU) Pleckstrin domain containing protein family B {ECO:0000313|EMBL:CDS39837.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000738400 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MAATFKPRLESDLSDAGSQGQNHHSRYCSGYQCIKTNGTLARSFSAEGGQMAIASRGSKV
EHKKEDDVDDASPQLEDVEALLRGYSHSHKSDDEDEELEEGDAANAGDEDEDDDDNAMNG
SSPILLSECPEFQAYLQPLQVSSQEGDPTLNDADEIVFGFVPRKNGKMPPRNKDEKDEEG
ALWELIEAEAEALCLSEQGLACCQSNAVIQSPVKRTSSHKCSKGAKQLTTGGVAALMNCA
ATEMSRLRVGAAVVRRAQSIEASRSPETPPTPPSPPSPPPKPKVPTQLRAQQRQEKTRST
TGTLASLLHIQLAQINRMSEAVRIEFSNQLAHERALLELLELEHNRVRSEVRIAERKHGS
APSDLVNQLRHLKERLEQQKTLIDDLEYQYLEDKTKYEEEKESLMAQLKLQEETPTEGSP
VITTPEKAKSTILREKSPEDAYTYPTAAFPSNRPLPTSSPIYSSPAKDSPVHFCGGSLDP
MNNDHRGHHFFVDNVNSSNLMNGVPPPLEEDSNRVAEPDSRITNCSRDDDFAHFPPSLIS
TGSPMQHPRGDLAVIDYKISLPTNTAPVFHQQNGRSFDETHFSERENFTGSPHTSSSLPG
GLNPHVAATSSNSSLLPIGNELHQSSCTSSSNNIFHAVPPLFPSTNLRGDQRQWIREESL
PIHCSDEVYIRHRQRTSSVATRKIWQDGEARPLTRYLPVPDDISFDLRHHLEVTCGHILC
SPLLMPHLHVDATTCAGYLYKVDSRVTSADNSLLEGLPSDISTVSSSTFFSPATRRARQR
APRVTSPSGGFMAALFHRSRRGKRRWFVLDRRRRLLIYYSSHTSKSSNAASLMKPKDVIS
FTDIIDVYPDQRARKSNNTSFCLLLVASCPPPPSLASPQSRPQPTRTRILSLAAPSPEAM
RVWVDALFTCAGAYLCLPNSHRSRHSGVDGER
Download sequence
Identical sequences A0A068YC89
EmuJ_000738400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]