SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YJN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YJN4
Domain Number 1 Region: 309-397
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.49e-16
Family Ras-binding domain, RBD 0.0081
Further Details:      
 
Domain Number 2 Region: 439-544
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000195
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068YJN4
Sequence length 844
Comment (tr|A0A068YJN4|A0A068YJN4_ECHMU) Growth factor receptor bound protein {ECO:0000313|EMBL:CDS42397.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_001010600 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MPNSGIIQDLDDWLLKLDNLQRALKSCSTNQPRRLQLPLASTREKQGDLYYRPLRTDQTF
EAVQATQLQSPPSTSPQRQNPPPSVRRVFSSADPQQREFDPSSPVHHYFPGEQFPTPNRS
DGEYLAEQNGVQPLSQPQHQPKSKTVRWSSEPAPHRPNGMQRLVSNLDSVEADLVNAASG
CSLNRSQRGLNPLDIPEIPPHPAFTDGNNHGGDCSPHSQTIPDQIPRVPKRQQFSSPIMR
YSPDPPIQNGTPPAERSSLQTQENYNTFTREKLPQAHNWVGNLNFWRSLQNRDGIDSLSL
RNQREKEDDKKVILRVHQPNRTTKAIYVQSRTDAGEVVLMLAAKNFLPLSTKMALVEKVP
SMKLERCFEDDEPVRDCILSWPVNSENLIFFEERQDLFGLFEDPQTWLGNTLVGESAQTK
NSLLIDILEKDGANRLPPFKDYLYILQPNNKWKRRYCVLRSSGLYASKKQGSDISELVRV
TAFGEHLHLYTTSGGWRKANAPTPYGFVLKPHSVVTMDPHMVRAFCAANEESLRIWCSLL
RIILMGPRLLQNYRQRLAACALNYQVPSDCAAGDEEGLAALEGTSAEASVNHLAGLVRHK
YARESNVYSGAGVRESARQYAKLPAIARARSVSQIQAQIATHQGSLRCSQFSLGPADRLG
ASVGDLGFVSGRTDVGRTSSMNELCVDECRATTSSTQSLNASQRLTCLFNPLRWSRRNVN
EATTPQPMRRSTARKGPAARKCNRSSSSLHRPPSISPSSSVFFLQNAEDSSARVSAAVEE
EQLNSMNQRQQQLEVQQSQPQQLPTLTYPSQRRQTTAPQTPHLPRHFAGIRPQLLPSQLS
PAAL
Download sequence
Identical sequences A0A068YJN4
EmuJ_001010600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]