SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YNE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068YNE5
Domain Number - Region: 69-145
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00036
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068YNE5
Sequence length 170
Comment (tr|A0A068YNE5|A0A068YNE5_ECHMU) Expressed conserved protein {ECO:0000313|EMBL:CDS43660.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_001145200 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MASNSAEFAIKVIDCFYELPSTDVLSLQTEVMDVESSAPLSPVHSSSAPSELPPIYGQEV
SEEWIEAHTQLTQEISSLREQLLRQPPPSSEVEVASLSESAQNLASQIVALQRGVESLHQ
FASQLAQITRAADQIQEVSEKLAALSTEEATGRPLKVLQEVSENIEAICK
Download sequence
Identical sequences A0A068YNE5
EmuJ_001145200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]