SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072BY73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072BY73
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-51
Family Ribonuclease PH domain 1-like 0.0000215
Further Details:      
 
Domain Number 2 Region: 292-463
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.71e-49
Family Ribonuclease PH domain 1-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 139-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.75e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 445-540
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.51e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 550-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.12e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 615-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.5e-20
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 
Domain Number 7 Region: 234-316
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.46e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072BY73
Sequence length 706
Comment (tr|A0A072BY73|A0A072BY73_RHILP) Polynucleotide phosphorylase {ECO:0000256|HAMAP-Rule:MF_01595} KW=Complete proteome OX=1408223 OS=Rhizobium leguminosarum bv. phaseoli CCGM1. GN=RLPCCGM1_c3419 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVVSAKAPKPGQDFFPLTVNYQEK
TYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFPEGYKNDTQVVVTVIQHDLENNP
DILSMVATSAALTLSGVPFMGPVGGARVGYINGEYVLNPHLDEMDESSLDLVVAGTYDAV
LMVESEAKELPEDVMLGAVMFGHKGFQPVLDAIIKLAEVAAKEPRDFQPEDYSALESEML
GLAEAELREAYKITQKADRYAAVDAVKAKVKAHFLPEEGEAKYTAEEVGAIFKHLQAKIV
RWNILDTKSRIDGRDLETVRPIVSEVGLLPRTHGSALFTRGETQAIVVATLGTGEDEQYV
DSLTGMYKERFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIRPMLPSAEQFPYTL
RVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAGIAMGLILEGDRFAVLSDILGDE
DHLGDMDFKVAGTADGITSLQMDIKIAGITEEIMKVALSQAQGGRTHILGEMAKAITESR
GQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVEKTGAKINIEDDGTVKIASSSGKEI
EAARKWIHSIVAEPEIGQIYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDV
VKEGDKVWVKLLGFDERGKVRLSMKVVDQATGQEIANEKKKEEAAE
Download sequence
Identical sequences A0A072BY73
491916.RHECIAT_CH0000147 gi|190889779|ref|YP_001976321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]