SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072TNJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072TNJ8
Domain Number - Region: 56-183
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00863
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072TNJ8
Sequence length 249
Comment (tr|A0A072TNJ8|A0A072TNJ8_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:KEH15160.1, ECO:0000313|EnsemblPlants:KEH15160} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_1988s0010 OC=Trifolieae; Medicago.
Sequence
RLPFVVEGCRQATAKTRPTTPAPAPMQATDFPDTELADLRAHGIVLFADRVIFDAQPPMP
ADQIAAVQARCHGDLPPALLELWRTTAGGSLDYDLTLEMNGHIEAIGWGELFYNGSNGYR
DLDGWIDHELELAEEAADEHSRPWSGRLDVLPFGGFEYCDRIYIVTDPDAKDRGHVLAWK
QGLPPAWRGAMHEDGLATVAPDLYAAFGALQLNADPLEPGGENGTGATLLDYIDARQAEH
GLSASLGDK
Download sequence
Identical sequences A0A072TNJ8
Medtr1988s0010.1 XP_013441135.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]