SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072V6Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072V6Y9
Domain Number 1 Region: 1-181,320-392
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.49e-60
Family Bacterial dinuclear zinc exopeptidases 0.00033
Further Details:      
 
Domain Number 2 Region: 171-303
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 9.24e-24
Family Bacterial exopeptidase dimerisation domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072V6Y9
Sequence length 392
Comment (tr|A0A072V6Y9|A0A072V6Y9_MEDTR) Allantoate amidohydrolase {ECO:0000313|EMBL:KEH37361.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_2g035405 OC=Trifolieae; Medicago.
Sequence
MEDAGLRTWVDQMGNVHGRVEGANANAEALLVGSHMDTVVDAGKFDGALGIVSAISALKV
MHVNGKLQNLTRPVEVIAFCDEEGVRFQTTFLGSGALAGILPATTLEIPDKRNVTVKDVL
KENSIEAAEEMFLQLKYDPKSVWGYVELHIEQGPVLEQVGFPLGVVKGIAGQTRLKVTVR
GSQGHAGTVPMSMRQDPMVAAAEQIVLMESLCKHPEEYLSYDGRCSGSSIKSLSSSLVCT
VGEISTWPSASNVIPGQVTYTVDIRAIDDLGREAVIYDLSNRIYQICDKRSVSCVIEHKH
DAGAVICDPELSSQLKSAAYSALKRMEGDIQDEVPTLMSGAGHDAMAMSHLTKVGMLFVR
CRGGISHSPQEDVLDDDVWAAGLATLSFLENL
Download sequence
Identical sequences A0A072V6Y9
Medtr2g035405.2 XP_013463121.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]