SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072VFH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072VFH5
Domain Number 1 Region: 30-224
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.98e-42
Family PAPS reductase-like 0.004
Further Details:      
 
Domain Number 2 Region: 295-404
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.48e-21
Family PDI-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072VFH5
Sequence length 407
Comment (tr|A0A072VFH5|A0A072VFH5_MEDTR) 5'-adenylylsulfate reductase {ECO:0000313|EMBL:KEH36875.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_2g023540 OC=Trifolieae; Medicago.
Sequence
MLNRKGMIQLFLLQQLSLHLIIEKEEEDFEQLAKNLENASPLEIMDKALEKFGNDIAIAF
SGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYRLFDAVEKRYGIRIEYMFPDAVEVQG
LVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEVPVVQVDP
VFEGLDGGNGSLVKWNPVANVKGNDIWTFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPG
QHEREGRWWWEDAKAKECGLHKGNLKQDDAAQNGNGNGVAHANGSAAVADIFTTQNVVSL
SRAGIENLAKLEDRKEPWIVVLYAPWCRFCQAMEESYVNLAENLAGSGVKVGKFRADGDE
KEYAKSELGLGSFPTILFFPKHSSRPIKYPSEKRDVDSLLAFVNALK
Download sequence
Identical sequences A0A072VFH5
Medtr2g023540.2 XP_013462839.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]