SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074STF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074STF3
Domain Number 1 Region: 35-497
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.57e-84
Family Acetylcholinesterase-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074STF3
Sequence length 517
Comment (tr|A0A074STF3|A0A074STF3_9HOMO) Acetylcholinesterase {ECO:0000313|EMBL:KEP53202.1} KW=Complete proteome; Reference proteome OX=1423351 OS=Rhizoctonia solani 123E. GN=V565_034370 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MVIWQRACALLLAGVPLIDAAALSVRDSSALSNGLLVDTEAGKVQGFYNNTAHTVRAFLG
VPFAAAPSGSLRFLPPQKRERPFDVIKATSWPPSCPGRYIHNPPSMYSLLPYFPIAGFSE
DCLSINVWAPSVSRLTKGKLLPVNIYIYGGSFEQGGTSIPTYEATDLVANHDVISVAINY
RVSIFGNPNSPYLASKGGALNVGLLDQRFAIEWIQRNIAAFGGDPKRMIAFGQSAGSISA
GYLPFAYPNNPIVTGIGELSASVLIPNPTVIMPELAQGNFTNLASAVGCAPGNTTDKQIF
ECMQNVPWQMLTDYIVGHPEMTYLFHIVADNITAFSSLEVTARIAAGKLARIPQFGGQLD
NEGDSLVPFSFDGINQTAADDFTYSLLVCPGAKEAQLRVNAGLPTFRYRYSGIYPNLSPY
PFIRTYHTSDVPMWFGAVNTVQGLKDQTTAEQKKQSAYMQGALVAFTQDPQQGLIKYGWP
LYQGSTGKTLVHLDPRNNSKVVVFENPAEFDAPCAST
Download sequence
Identical sequences A0A074STF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]