SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074SVF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074SVF6
Domain Number 1 Region: 303-519,551-594
Classification Level Classification E-value
Superfamily vWA-like 3.19e-48
Family Trunk domain of Sec23/24 0.00027
Further Details:      
 
Domain Number 2 Region: 26-75,163-212,600-708
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 7.06e-47
Family beta-sandwich domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 3 Region: 218-302
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 4.32e-25
Family Zn-finger domain of Sec23/24 0.0004
Further Details:      
 
Domain Number 4 Region: 838-988
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.45e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074SVF6
Sequence length 1018
Comment (tr|A0A074SVF6|A0A074SVF6_HAMHA) Transport protein Sec24, putative {ECO:0000313|EMBL:KEP60658.1} KW=Complete proteome; Reference proteome OX=99158 OS=Hammondia hammondi (Parasitic protozoan). GN=HHA_277000 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Hammondia.
Sequence
MYTQPNLPGGTPSYPAGAPQASRDAAPTQQPFYGYGSQPSPSDMRQGYANPPAQSYSNGM
PAYPSDPASVPSYPAPPLASGNPQSAAGGYASQRSVGGIPSSPFHAATPANPGAAPPPRT
AYYPSGVQSSGYAGYGAAASGVSHSAALPADSGAYASTGSAAQQVLQEIQQFNSPRYFTR
ASVARVPHSSSLQQKLHLPIGLFIRPLAPIRPGSPTVPSVNFGNCGVVVRCKRCRTYINP
FVHWEAHGRRWSCNLCGYVNDTPQFYMRGLDEKGKREDRFERAELSMGSVEFVAPADYMI
RPPQPPAYLFLIDVSATAVASGLVESACAGIRAALTSGKLPGCTDSGAGRGDSRTMVGIV
TYDSAVHFYALGSASGGGKRRPQVLVMPEIDDVFLPLSDDLFVNFAENRDAVLAALDTIP
SLWRSNGCIDNCMGSAVKAALLVMKHVGGKIMLFASFPPTVGALVTKRSGGLAGADSAGT
EGGSRQQPDREIELLKPASEAYQQFAQQLTQSQVSVDLFIAPSSCASPAAGNVPPSGTYA
GGKPGSGAPGLVTAPYCDLATILPLAELTGGEVRYYSAFSRLQHSQQLENDIVHIITRTT
GWEAVMRIRVSRGWKISARHGRFFLRGTDLFVLPTVNADSTFSILMELDEQAGAGGPGNA
LVTPPSGGDNVVAVQAALLYTNSDGERRIRVHTFCMPVSQNIQDIVSSMDPEVVTCLLIQ
QAIDQSLRSKIADGRAFLQTSCSQLLSVLHSVGSSSQLAASYALPSLPHYGAVAAASAGN
PAGGALLEAGRLVALFVLGVLKSNAFRPVKEVSTDKRVFSWSRLLALPVDRICAYVHPRM
LPLHNLSNFGGASDVLDGQEEVILPPALRLTAEEMTQDGAYLLENGEEMLLWIGRSISPQ
WLASVFGAHSLDCVHLDVAAASVGDSQDPVGLRVRAVVQSVQGEHLCNAMRLLVIRQGDP
SEQKFFAQLMEDRVPSLLLTFAEFLQKVDVRSQLQAPAPPMIAAAGGAAPPLQQPRMY
Download sequence
Identical sequences A0A074SVF6
XP_008888723.1.28481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]