SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZUW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZUW6
Domain Number 1 Region: 49-283
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.47e-48
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 260-382
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000132
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 437-479
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000183
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074ZUW6
Sequence length 522
Comment (tr|A0A074ZUW6|A0A074ZUW6_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER30941.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_02751 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MTTSGTAIPGLAFYDALVNNSLVELKRCVELHKIDLNARLSHVRKRNHTDLCPVHLVAYK
GYFAMLHYLIQNGINVHQPTLTLQRRAVHFAALRHQVSCLQMLLNAGAQLDARDTFGNTP
LHYAAEDGDGALLSLLLNNGASVDSQDITNKTPLMKAARSGKLWAVRRLIAFGANVNVKD
RNDETALHFACRQGSTEITSMLIKLNDFSLFLKAGARLNAQNQIGLTPLMEAVSYNQREA
VSLMVKQRGVDLYKRDFCTGDTALHIAVKKNYIHMVEILLQAGNWYIEYNYNNLGESFVH
DVIAYNRLDLLRLFLAYNYDFDRPAKRLPASILGAVVPEASSSSNTTVGAGGSFSNTCEK
SPFQLALERGHLDLARILADVGCYRIKLPITSGPFTLPLSLYTTSALQSNNSTTSWPNVA
SLSNSSSLARRYSGLLEVKSLKKWCRRAIRQLLGFRLTEALPQLPLPIALKDFLLLRDID
WYVCWSTAMAHRGSSNTSELAIIVPPRYTTHSPTQRSNSTRT
Download sequence
Identical sequences A0A074ZUW6
XP_009165330.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]