SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075FBW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FBW5
Domain Number 1 Region: 74-261
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-54
Family Protein kinases, catalytic subunit 0.0000991
Further Details:      
 
Domain Number 2 Region: 37-78
Classification Level Classification E-value
Superfamily PH domain-like 0.0000336
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075FBW5
Sequence length 265
Comment (tr|A0A075FBW5|A0A075FBW5_9CILI) Protein kinase domain containing protein {ECO:0000313|EMBL:AIE77206.1} OX=151077 OS=Chilodonella uncinata. GN= OC=Cyrtophorida; Chilodonella.
Sequence
IYKQNEEASHISSALKIKYAQVKFPTPEEMEASHSKSPGGKFAIKICSRGKYSVLFARNE
EEYQLWMAQLSKVMLRVDFHSKYQVTKAIGQGAFANVYEATSRVDPQQKFAVKGFNKAVL
EAQPREKQSLWNEITILRQLDHPNLLRLHEVHETQNSLYLVTEVVSGGELTQFLDENKTL
TNNDLRNIAIGLARGINYLASKQIVHRDLKPNNVLLRKTSNFTDQDVVIVDFGLATYTHS
KNFIFKRCGTPGYIAPEIISSANPE
Download sequence
Identical sequences A0A075FBW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]