SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077L1H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077L1H9
Domain Number 1 Region: 14-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000144
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077L1H9
Sequence length 142
Comment (tr|A0A077L1H9|A0A077L1H9_ACIGI) Uncharacterized protein {ECO:0000313|EMBL:BAP35924.1} OX=106649 OS=Acinetobacter guillouiae (Acinetobacter genomosp. 11). GN=AS4_09840 OC=Moraxellaceae; Acinetobacter.
Sequence
MVIQKLKQHFINQNVRINQPTTFLETLEFEQKYGVKLPQIFKEYFIFFNGTGEANFGDEG
YSFFSLAEFRPVKDLNGTEDFPHANCFVISEFLLWMTAYAVKLDEYGNEFGIYEICNTHN
KVCNSFEEFISMMITNDCDHHS
Download sequence
Identical sequences A0A077L1H9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]