SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077X693 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077X693
Domain Number 1 Region: 69-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.33e-27
Family Thioltransferase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077X693
Sequence length 168
Comment (tr|A0A077X693|A0A077X693_PLABA) 1-cys-glutaredoxin-like protein-1, putative {ECO:0000313|EMBL:CDS44910.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_040310 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MIIKNKITIFLPLSKVVMGTNSNLFRFVSTQKAKFSNSSENNKGKTHENMINNNVTDFKD
FEKTEIYQNLKTKIKDILEKEKIVLFMKGTPEQPLCGFSASVVQILNKVNVKDYVYIDVM
KNRNLREAIKIYSNWPYIPHLYVKNNFIGGCDIVSDLYNKGELETIVK
Download sequence
Identical sequences A0A077X693 A0A0Y9UAN8
PBANKA_040310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]