SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077X6F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077X6F3
Domain Number 1 Region: 629-682
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000581
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 473-603
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000085
Family Calcium ATPase, transmembrane domain M 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077X6F3
Sequence length 685
Comment (tr|A0A077X6F3|A0A077X6F3_PLABA) E3 ubiquitin-protein ligase, putative {ECO:0000313|EMBL:CDS45021.1} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_041010 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDNSVERIEGEDGEDSNDVFLYSNETNQDSEFCNILCMFIFFMALFIIMIAAVDNKAPNN
NNEINYNSENGNVSNNLTNDDVINNFLENAVIQSFDFKGSYKIKKKKNSIQNVEGNNLNP
QNKQNDNIFEGKIVTLKLALQNITKSFLFLHFYPTNVNIKEMKNEGNEKIGSNYYLTYER
RNKKDDKKLEYIGMVGVNINGSQSYIFNGNGYNISTFCKNELDDNCICNYTANIKQNTKI
NQLAYVREIEESYFYSLKKYIIDEQAYFNNNINEKYRKYYKKNMEAISPRLTDDYNDNIN
NNNNNNNNNNNNNNNNNNNNNNNNNNDNDKSYLSQFSNLEYNQNKEANYHGLLLSNDCNI
EMILKGYDEDNVYFSKKVRNFILMFNLKSLIELGLFYKQIKNSENMRNTSKVSIISICLN
SYIEIFEALLLLYQVLFSKLLLTSYMAMIILKFLLYTLMEIRYILIIWKINNSHNSANNN
WEYMQRQLSVLYKYYYSFVLLLIAIFYYIFPYFPYLILFIYFCWVPQICLDIWKGQHKSI
SLNFVFLLSLCRLFLPIYIFIYPYNIFQLDIFSKVAGLSNNTFCFLLIFFILLQLIFMYI
QRMYGPRYLFNISLLPHVHNYYQNLDPNFEAGIQECVICMYNIILNNTKYCITPCYHIFH
EKCLQQWMCIKMECPTCRGSLPNFP
Download sequence
Identical sequences A0A077X6F3 A0A122HVQ1
PBANKA_041010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]