SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077XKG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XKG5
Domain Number 1 Region: 35-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000394
Family Thioltransferase 0.079
Further Details:      
 
Domain Number 2 Region: 350-431
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.000000837
Family FAD-dependent thiol oxidase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077XKG5
Sequence length 516
Comment (tr|A0A077XKG5|A0A077XKG5_PLABA) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PBANKA_145540 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKIYGYIFSILFIVPNLVLNTWGSEHSDICKKGEVVLKNFWDKLNNIKHGDILFINIKNY
YCPACNKYMDTWNKLEKDILNFEKNVSMFVFDCSCTIFYPYCRFFQIKYFPTFRLLYPIY
DKINDSNEYKYLSPNTNIGNETYTGNMLIAYNDVERVNKLEEFQILLQTHLCNNVSFNNI
DIKSCYYDILPPVIDDNIYNNFPFIEIYNNIFGNNRGETEEEKQKIRLLEKWNNNINNKE
YIKHDIIKGLLFTLKKNVSLSVDINKEIIQPYINMLQIVEHIYPDIAPSLIAIREKLQSF
KYPIPHEEWIKLVNTEKDNEEKSVFLIDGYNIDLDNVQRFKICDDNSVLCAYWLLYHKIS
IYCLLHDKERYNYYLESITNYTKNYLNCRNCVSHFIKAQKFCYYGFCNINSAESFVIFLW
RIHNSVTLRTTYDHIISDIRLNILSKSKQIQFLHKDIAFPSEKQCNYCRNNIGFTKITPN
RINEMLNDVPYSSKDFDAVDAFNIMYILRYLVSIYS
Download sequence
Identical sequences A0A077XKG5 A0A113T6L2 Q4YS40
gi|68076849|ref|XP_680344.1| XP_680344.1.11252 PBANKA_145540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]