SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077YEV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077YEV0
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily MTH1598-like 1.12e-45
Family MTH1598-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077YEV0
Sequence length 217
Comment (tr|A0A077YEV0|A0A077YEV0_9APIC) Protein archease, putative {ECO:0000313|EMBL:CDU85010.1} KW=Complete proteome OX=5861 OS=Plasmodium yoelii. GN=PY17X_1017200 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MGDFPNNQITSLPQRNRRRINRNYAHEESKSTCTNEIEENEATNDENVDKNADKNANKNA
DKNMMSDIEICNINLNKNYKYEYLDHTADIILHSYGNNLKEAFESVCVALFNYMCDLKNV
ELKMKRKISIKGDDLDDLLFKFLVEFHFLYGNEYFICKTINIIVFDIEQFYIEAYGYGEL
FSTYKHECGTEIKAITKHELKIVSNYNSCEVFVLVDI
Download sequence
Identical sequences A0A077YEV0 Q7RRN2
189.m00113|PY00687|PY00687|Drosophila 73239.Q7RRN2 XP_726293.1.76580 gi|82596517|ref|XP_726293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]