SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078F576 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078F576
Domain Number 1 Region: 2-46
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000706
Family BCR-homology GTPase activation domain (BH-domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078F576
Sequence length 118
Comment (tr|A0A078F576|A0A078F576_BRANA) BnaA05g27570D protein {ECO:0000313|EMBL:CDY08521.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00000297001 OC=Brassica.
Sequence
MLPSTEASLLDWSINLMADVVEMEHVKKMNARNIAMVFAPNMTQDRKESRDRLIPGSNPS
PRDENGDQTSRQLVHLMEANMEVALDDTFEVEMKDKEDSAEEEEYAEPREILGVKSEG
Download sequence
Identical sequences A0A078F576 M4F191
Bra034837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]