SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078I463 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078I463
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.72e-31
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 2 Region: 199-310
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000329
Family Calsequestrin 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A078I463
Sequence length 578
Comment (tr|A0A078I463|A0A078I463_BRANA) BnaA05g29350D protein {ECO:0000313|EMBL:CDY44671.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00080647001 OC=Brassica.
Sequence
MVRTQLVVSVVLVSTLLLLNAEAKTVDPYKVLGVSRDAKPREIQKAFHKQSLKYHPDKNK
NKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGQPGFGSGFPGGNGGGYSYSSGGGQG
GGFNFGGPGGWQNMGGGGGGGGGSKSASGSSFGFGMDDIFSMFGGGGGGAKGRDQFGGFG
GFGGGSSKAESGSKRGSVATVKTVTSQVYKKDIVDQGMTWLLLSYLPSQRGTQYHESVIE
EVAESLQGALKVGRINCETESSLCKQLGVVPRRAPRLFVYSYTSSGKATLAEYTEELVAK
KVKSFCQEHLPRFSKKVDLNTFDVSAISSQGIPRVMLLSTKKDTPVIWRVLSGLYNGRFV
FYNTEVHDASDPKVKNLGVDAFPAIVGWSSNGEKQVLKTGITVKNLKSAVQEIGKLLEGF
EKKNKKASSNSQSGQGKSEPVEKIHLLSRTNFDSICGEKVPVCIIGAFRSPQGKEKLHSI
LSKVSQKSLSRRQASGTGSQDTVSYSLVDAAKQSSFLSSFDKSEFKASDKLLIAYKPKRG
KFATFKGDMTMEEAEKFVAAVLNGDIQFTKTRQKPQIK
Download sequence
Identical sequences A0A078I463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]