SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078ID68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078ID68
Domain Number 1 Region: 391-633
Classification Level Classification E-value
Superfamily vWA-like 7.34e-65
Family Trunk domain of Sec23/24 0.0000239
Further Details:      
 
Domain Number 2 Region: 136-300,635-699
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.14e-50
Family beta-sandwich domain of Sec23/24 0.0058
Further Details:      
 
Domain Number 3 Region: 783-922
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.39e-28
Family C-terminal, gelsolin-like domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 4 Region: 308-389
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 6.67e-25
Family Zn-finger domain of Sec23/24 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078ID68
Sequence length 926
Comment (tr|A0A078ID68|A0A078ID68_BRANA) BnaA06g39000D protein {ECO:0000313|EMBL:CDY47304.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00087135001 OC=Brassica.
Sequence
MPGSGPRPSPPFGQPPPQPYPQSAPSYGVQPPPRPSPMPRPGPPPPALTRPGGPPQLSQP
GGIPFGRPSGPPSSQPPFGSRPPGAFPGPPGRVAAAPPSGPRPVGFGSPPPMGPGMSMPG
GFPRGSQFPGGSMMGPPPPYGQPPNAHSLPGGSPLTSPPAHSIPPPTTFPGAPYAMPGGF
PYGLPPQQHPSAPGTPGSMYGMGPVPNQSMTTVSGPSKVDLNQIPRPGSISGPIMYETRQ
ENQANPPPPTTVDYIARDTGNCSPRYMRCTIHQIPCTVDLLSTSGMQLALIIQPLALSHP
SEEPIQQVVDFGESGPVRCSRCKGYINPFMKFVDQGRKFICNLCGYTDETPRDYQCNLGP
DGKRRDADERPELCRGTVDFVATKEYMVRDPMPAVYFFLIDVSMNAIQTGATAAACSAIQ
QVLSDLPEGPRTFVGIATFDSTIHFYNLKRALQQPLMLIVPDVQDVYTPLETDVIVQLSE
CRQHLEILLESIPTMFQESKSPESAFGAAIKAAFLAMKSSGGKLMVFQSVLPSVGIGALS
SREADGRANASADEKEAHKLLQPADKTLRTMAIEFAEYQVCVDLFITSQAYVDMASISDI
PRTTGGQVYCYYPFSALSDPPKLYNDLRWNITRPQGFEAVMRVRCSQGIQVQEYSGSFCK
RIPTDIDLPAIDCDKAVMVTLKHDDKLQDGAECGFQVLLWPFKIISMPKCWFTSFISCLR
FLYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYI
YIYIYIYIYIYDNEETVVPSPIPLTSEDLRDDGVYFLENGDDGLIYVGESVNSDILMKLF
NVPSAADIPSQYVLEKYDNQLSKKFNDVVNEIRRQRSSYLRLKLCKRGDPTGMLFLSYMV
EDRTAGGPSYMDFLVQVHRQIQGKLN
Download sequence
Identical sequences A0A078ID68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]