SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A078IFV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A078IFV9
Domain Number 1 Region: 140-318
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A078IFV9
Sequence length 437
Comment (tr|A0A078IFV9|A0A078IFV9_BRANA) BnaA04g26720D protein {ECO:0000313|EMBL:CDY48018.1} KW=Complete proteome; Reference proteome OX=3708 OS=Brassica napus (Rape). GN=GSBRNA2T00088664001 OC=Brassica.
Sequence
MTTFSRSKSTGATGFTDSKPTRPGPHMYENIHGDKYKEDHSPTSIDYYDVSTPLSSHGSR
SGSGQFTMLDLLAAVLRKSLVMSCAMERGGDDMAASMDIGWPTEVKHVSHVTFDRFNGFL
GLPSELEPEVPPRAPSASVSVFGVSAKSMQCSYDNRGNSVPTILLRMQKRLYTEGGLKAE
GIFRINPDNAKEEYVRKQLNGGVVPRGIDVHCLAGLIKAWFRELPTGVLDVLTPEQVMKC
NTEEDCSRLVTLLPPVESALLDWAIGLMADVVEYEQFNKMNARNVAMVFAPNMTQMADPL
TALIHAVQVMNFLKTLILMNLKERENAYAKSRGIDKQTSDPSEEWESHDSEILGPKKSSN
NPKFLRVSTLCRLEADNEEEFWNTEKRHDHNDTAETIGTVQRLSKLSKSTKKPLESNKDE
GRRGREAWGSRLSSLPW
Download sequence
Identical sequences A0A078IFV9 M4FDU1
Bra039262 XP_009142439.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]