SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080YUZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080YUZ5
Domain Number 1 Region: 21-145
Classification Level Classification E-value
Superfamily Lysozyme-like 1.56e-37
Family C-type lysozyme 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080YUZ5
Sequence length 146
Comment (tr|A0A080YUZ5|A0A080YUZ5_HUMAN) Lysozyme-like 4 {ECO:0000313|EMBL:EAW64648.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_28863 OC=Catarrhini; Hominidae; Homo.
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAWPTWSRYCQYSDTLARWLDGCKL
Download sequence
Identical sequences A0A080YUZ5 G3RHB9 Q96KX0
ENSP00000287748 ENSP00000387897 ENSP00000287748 ENSP00000387897 NP_001291315.1.87134 NP_001291315.1.92137 NP_653235.1.87134 NP_653235.1.92137 XP_004033966.1.27298 XP_016861194.1.92137 XP_016861195.1.92137 XP_018879088.1.27298 XP_018879089.1.27298 XP_018879090.1.27298 9606.ENSP00000287748 ENSGGOP00000015037 ENSGGOP00000015037 gi|21389465|ref|NP_653235.1| ENSP00000287748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]