SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A080Z264 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A080Z264
Domain Number 1 Region: 277-540
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-22
Family Ankyrin repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 44-150
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000602
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A080Z264
Sequence length 642
Comment (tr|A0A080Z264|A0A080Z264_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO60725.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_21139 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
KQQMPLFQLRVVEFVLRRHPDVASLPHIGPLVSSFLGPSSNLSLTEACKLGSTTLLDWIW
DCSTTSVSGRIPGWTLCNYLRSEDHYYQWQFHKATQIAASRGDSKTMEWLFTHFSGCEVP
SEAVTNAAGNGHLPILEFMLNNDAGWDFNREIVQMSYGEGGEDSWFEGVPDLPEDWDGPG
NVVRWGGQSMEAAVRCRHYKVARWLKDYVPYESTEGELETIIEIAVNDGAMEFAEYLMPA
DRQILEYIHERARPEAVGWVLEREDVRKNQDFGAYGIVIAALHGNLDLMQRLARTRNKRR
KITIWPREWKFSIELACSRGNFEMVKWMMEHPLGPEACASMKDQCTFDDLLYKAAKSGNA
ELVGYLLDQGCDDTNAYAIRNAAAKGHLECMKVLLERCARCMYSDREPVESAVVEAARNG
YLEILEFLHVQDPPLMHPCTERDRQTSPKRRKVESTNIWWARSIEAFNAAAGKGHLEVVK
WLHGNRYRGWTTDAMDDAAGNGHFEMVKWLHTNTKVECTKRAMDDAARNGNLEILKWLHT
NRSEGCTHRAFSHAINNGHLRVAFWLRSKDLSVAPPTNRFWLRSNNQFDVLLFLRVNCPD
IFTTEFGQEAKYDYSGDAARPGDYLIEGWLEENYPVYPAEEE
Download sequence
Identical sequences A0A080Z264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]