SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081ATD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081ATD2
Domain Number 1 Region: 344-472
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.76e-25
Family Chaperone J-domain 0.00018
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000393
Family Ubiquitin-related 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081ATD2
Sequence length 476
Comment (tr|A0A081ATD2|A0A081ATD2_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETO82143.1} KW=Complete proteome OX=1317066 OS=Phytophthora parasitica P1976. GN=F444_03688 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEGGIWAFYYLQGEDGEDRSHPNAFKLTGLSPGTDVTLADVLRSFPLRNPSAFHFRFRLN
SSKGNTFYWLDVTQPTQKVPLAGGRVICKLLRLERPQKPGLVFRRRPVLKWASGSQPPKR
QGSSSALGDSSNSVQSAKAVQPLGESSNFHRSSSSPGFEQGRPAKYSDRAPGSGNGAESR
HSNSSSRTSSTSGDKKPVSRTGSGSKTTEAQGNLEDFLSGGQKASGAAATPTPSPPKKDV
NLMSDSGWTDAPATPAQPANATSDFLNSMDPLAARATPAQPSPSKAVQRDPPKFDDDNGQ
TVGPVTMAEMEAHSKSTSDGSNVYNPNLVDKSTKSDDVRRAMEERERQVQRDVKRAREDL
RKREEAVRNMAAMKDSASAVLGPKLKAWAEDNGRVKNIRTLLSTMHQVMWEDCKWTEVNM
GKLIQPNDIKKHYRKAMIVVHPDKSGGRNAEQLLIAERVFAALNTAWEDFQKTNPC
Download sequence
Identical sequences A0A081ATD2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]