SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081CCE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081CCE1
Domain Number 1 Region: 187-278,305-371
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000458
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A081CCE1
Sequence length 798
Comment (tr|A0A081CCE1|A0A081CCE1_PSEA2) Uncharacterized protein {ECO:0000313|EMBL:GAK64337.1} KW=Complete proteome; Reference proteome OX=84753 OS=Pseudozyma antarctica (Yeast) (Candida antarctica). GN=PAN0_005c2550 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Moesziomyces.
Sequence
MIAQVSITHPSLRPASSLDNSSDSPPAPHRQQRPSPAMSGSSFFSQISSFFGASPNSNSR
SGARHSSPFSSGLPSSSRRGPPQALDANAWSLPYSSRSSIPASPAYPTDAPNSATDGHYP
PAAGIARASSPYAHDHPPISTSSVAEFSNMYPTASTSTLVPGTAANTLSVSAGGSVPTTA
YPPMRHTWNRIRKWCRKNYPEMSDTLNWPCTEDALDELEMTIGYALPSAVRESYLVYDGQ
ELESNQSCQDGLFFGAALLSLEQIAEEWKFWRAVDEDPETAANPHVRNLMASCPHKWIRP
EYSCRGWIPLITDHAGNYIGIDLSPHPAGAGSPGQVIIFGRDFDTKVVCWKGEGAGGWGR
FLQSFADELDAGEFWTLEELTSASEDEEDVIGYQSYFSGGGAGAGQGGGDRGGEGAAAFR
LQGQYKGWPVLEAWADRSVRLWESVGLAPGKPVGNAQQPAQPQPQSVVNRQSQLFGDDTG
IPPSVQAVNENGEAIDAEGSGSQRPAIAVGKELAGQVSVDGPAHPLADASLAGDTSAEVL
IAPADSTLATDATTVTVDTQAADAKEADGSVDVNLTPTNSTRRVSGMLSPPLPETKASLR
KQKQREEGWGSPMLNQSVAMGQQPRRPVRPAPAPAATLDLPTIEDVKAIQAAALADDGKS
HNVQFDSHPQARSSFTNLGFRDLAGKIGAPGMGLGGGSNGNAVGSPQQRSESVELETRSS
VENRSANSYIVGQRGRARGLGLEAGEDEAAAEAFGAMSVSAAKTREMPSLIDASSAPGSP
LVRGTPKLSEAEVPAALA
Download sequence
Identical sequences A0A081CCE1
XP_014657277.1.33630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]