SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081CCM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081CCM5
Domain Number 1 Region: 223-310
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000224
Family Thioltransferase 0.083
Further Details:      
 
Domain Number 2 Region: 444-547
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000204
Family UBX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A081CCM5
Sequence length 582
Comment (tr|A0A081CCM5|A0A081CCM5_PSEA2) Uncharacterized protein {ECO:0000313|EMBL:GAK64421.1} KW=Complete proteome; Reference proteome OX=84753 OS=Pseudozyma antarctica (Yeast) (Candida antarctica). GN=PAN0_005d2635 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Moesziomyces.
Sequence
MSTQRSGSQQDAIASLRSILQGSGAGVPDDDMLATLLEVEGWDVTRAARLVEEDNTAERR
RSGADDETIARSFAQDPQVRGSMDFEQPLIDASRRSFNGAAGNMGSLSGGAGLRRYPGPG
DNSGPSGVAQMIWTALTLPFSVASSLLLFLARVLRLRSLFPSLFGSGGGSQGSSASDPRT
SAERFVRELELETGGTTSRSGPSTGQGPQEDGYDTGSSVLKRLPPFFVGSYTDALRQAKE
QIKILAIVLVSREHGDVDRFKQNTLTDNELVELLSRDDFIVWGGDVREREAYSVARTLQA
STYPFVAFIALQPPRQSRRAAAASLGSSPRPAVLSRLEGSPSSATSAASIASHISDVLLP
RTRVYMDRLRAERRRHEMERELRAEQDRAYQEASRRDAERIAQRREEERRKAVEAQRRRE
EHEQKEELQRRQQVWRRWAFNSLVPREPGATQEAVRFSVRLPSGKTLARRFSPLDPVEAV
FAYVESASVASEASEGRAEVRKPEGYEHTYRFSLVTGYPRKRIEFGDARASKLRDVEGLA
QGASLIVEGHVLGDAASATDDEEDDDDDDDDDATPGGVAARA
Download sequence
Identical sequences A0A081CCM5
XP_014657361.1.33630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]