SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086L4Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086L4Y9
Domain Number 1 Region: 113-351
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-57
Family RecA protein-like (ATPase-domain) 0.0000000264
Further Details:      
 
Domain Number 2 Region: 43-99
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000022
Family DNA repair protein Rad51, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086L4Y9
Sequence length 354
Comment (tr|A0A086L4Y9|A0A086L4Y9_TOXGO) DNA repair protein RAD51 homolog {ECO:0000256|RuleBase:RU364139} KW=Complete proteome OX=943119 OS=Toxoplasma gondii p89. GN=TGP89_272900 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MSAVSLQQSRAASVQESEPQQQQAQQLAEEVQSGPLKLEHLLAKGFTKRDLELLKDAGYQ
TVECIAFAPVKNLVAVKGLSEQKVEKLKKASKELCNLGFCSAQEYLEARENLIRFTTGSV
QLDSLLKGGIETGNLTELFGEFRTGKTQLCHTLAVTCQLPIEQAGGEGKCLWIDTEGTFR
PERIVSIAKRFGLNANDCLDNVAYARAYNCDHQMELLMEASAMMAESRFALLIVDSATAL
YRSEYTGRGELASRQTHLCRFLRCLQRIADTYGVAVVVSNQVVAKVDNMGGMFSGNEKLP
IGGNIMAHASQTRLYLRKGRGESRICKIYDSPSLAEGEAVFAIGEGGIGDYEDN
Download sequence
Identical sequences A0A086KF92 A0A086L0L2 A0A086L4Y9 A0A086QWQ2 A0A125YQJ6 A0A125YQJ7 A0A139Y5X0 B9PFU0
gi|211963576|gb|EEA98771.1| gi|237833229|ref|XP_002365912.1| gb|TGVEG_020310 gb|TGGT1_112080 gb|TGME49_072900 XP_002365912.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]