SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086LPQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086LPQ2
Domain Number 1 Region: 637-703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086LPQ2
Sequence length 1218
Comment (tr|A0A086LPQ2|A0A086LPQ2_TOXGO) Thrombospondin type 1 domain-containing protein {ECO:0000313|EMBL:KFG58620.1} KW=Complete proteome OX=935652 OS=Toxoplasma gondii RUB. GN=TGRUB_277910 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MMPATRRSASLLVSARGSAARFPASSVSFLHKGAAGVSRRFSASLSPFSCSAFVSPSCPM
ASSSPFSPPHFSSLVSSPSSPSAGFPRSASSSASSFPPCSSAGVPKVSCLKLSCGERQQE
GEPSLPRSAEERKATNRRELECLRALQSAVAEREAEADGGWTTWRGVSQRTWKQKRPALL
SSRITAAMSLEEEDSTSGPRGDEEERERRSGVCGERGQNGGEKLGRVQGVSTGDSESRTR
CCRGLHFSPQTNRFFVVLLSCLLFFLVGEVQEVCPPSLQRMESSTDFFFFKIASAEAHTA
NPGDSSKSRRRSPRSSRFTSKASSDSSSSSRSSADSSSSSRSSADSSSSSRSSADSSSSH
PSSSSSSPLSSSPDSSPEEVNGLRGRARVWTRRGGLSSRLREFLSDASALRSQESAADAV
EEARARVRLLSRFARSRRQTLEALGGKSRRSEWRRKRTGMMASEARESHRGRDLNTLADR
EKKALKSALLAAQLSRRRMQSIQSERSLYSLVRPLLDESDAAGVYTANECVAVRYADYPK
EFPGYDISTESCRCPDGWLPCAESDAVARMSAWEPVIWEENADEGCTSERGEVMLEHMNF
YSCPQRTFVEYTGPRDATIRDKQCKRVAFVLCRAATSSCITGPWSEWTSCSVPCGEGYQY
RWRIPVTGASSSTDKGAVTQRSSREACAPYHMEERRKCNLGACPEKITKTTCFWTTVQVD
RAEGAFDEDQGSCKCGTGDDAIDREEGAMVPCTPEEAVASMDNWKSHFRQHCYTSLGLRR
RSNLALRFHSYGHVVRLGLRDLWHLDCTGGWSKFNIFEAKMFCGVGAKILCRSRTDSAQV
PFSMEQHNAESDAVTRISMLLKRQRRVEEASPQAFAEESLLLSEGGVSHLWISLFAGAVA
AVVFLVCLTKRAAVGTFLRSRVSTATAGGETVSAKGSTRGSRNAGRRVFSAQAVREAVEE
RVHAFVAFARSQTTAVILATEKWMETAAEREVTQEMQGVSTASLRLLERDCKEREERDSA
RKSCPQEAKGLLEGEEDVPALLVFPALKTATDRVVRVARSTLSLETRSFSGAQRSAQRLW
GKVRSIFLARGKEKRDEDLFYGEEGERGRIQRGGPAAFVSSLACQKVERRRARRGRREGD
SGEGGDCGEARKANSGVAGRLDSLTEMERDDSFVLSAVEEKLLFPRGKRNTQEKLARINK
AARTAAVSAVTPESFGSM
Download sequence
Identical sequences A0A086LPQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]