SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086N438 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086N438
Domain Number 1 Region: 140-226
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000127
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086N438
Sequence length 265
Comment (tr|A0A086N438|A0A086N438_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KFG75906.1} KW=Complete proteome; Reference proteome OX=1915400 OS=Streptomyces luteus. GN=FM21_07285 OC=Streptomyces.
Sequence
MELTQSTISDLLTRLGPGPRHLRLPGDLDPQDLVDLLGDRFGAPRTLVLDGFTDPTVEES
GGAALLVPFAGRAVTIRAWAYGDQWVGAGTARDTEGVERPVLVVAHRKVPQPLAVAPGED
VDWLERLRRITGWTGPARRPDADWAEIESRLGTALPSDYKRMVETFGDGAFDGYLGLFQE
PWADRGEGGLLVWAGTEHEDQYCWRADGDDPDRWPVLVRSFDGDDLVFDCRTAEFVCRIL
VDPHHPYTMARYFDTHWFMGYGTGD
Download sequence
Identical sequences A0A086N438
WP_043373786.1.42235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]