SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086TBE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086TBE3
Domain Number 1 Region: 131-218,282-349
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-18
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086TBE3
Sequence length 531
Comment (tr|A0A086TBE3|A0A086TBE3_ACRC1) Glucan synthesis regulatory protein-like protein {ECO:0000313|EMBL:KFH46675.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_025640 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MANSFGSAFRSFWHTMTSYDRHSTYDSPHRSGRHVPLQNGRTNNVFTGVATASDSRHDIN
SPYHDENGRASPSHDGIPGSPGGGAYSPGLRSVAAKNASQADGFEVQSPGEVPMQSFEDG
LPPPPPVAHSWRRIESWAEENYPELWDQICEGATVNDLNELEHQLDCSLPQDVRESLMIH
DGQERGGMPTGIIFGSMLMDCEEIVQEYYQWTRVNQQFLSEVPPVRPTVPSKTFGRGSSS
EPSSSRQRPSSQGSNPDEWRQNLLQKQDCVPPGAVRKAYAHPGWIPLVRDWGGNNLAVDL
APGPKGRWGQIILFGRDYDTKYVVARSWSAFLALVADDLNSAKWYVDEDTSELKLREFNT
TRVEPPYFGILRWRMDQKYGRRAPNRKSMAPPVKNPSPLGSRSSSPYASPVEANGDARGR
SMQRLRGTSPLTSPMRAGYGKPPPLSRVTEEATIPELASANIEPTKLVEVETPRDSEESS
KHSKTTPAQPLARAESDLIKLKDNKENVSPGTTTSSKQAKVEDESMRDIEI
Download sequence
Identical sequences A0A086TBE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]