SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087QU56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087QU56
Domain Number 1 Region: 1126-1301
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 688-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.26e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 3 Region: 350-425,480-574
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-23
Family Pleckstrin-homology domain (PH domain) 0.0000367
Further Details:      
 
Domain Number 4 Region: 897-1038
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 5 Region: 1436-1558
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-16
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 6 Region: 590-703
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000755
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 7 Region: 8-71
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000353
Family SAM (sterile alpha motif) domain 0.00037
Further Details:      
 
Domain Number 8 Region: 1017-1118
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000015
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087QU56
Sequence length 1695
Comment (tr|A0A087QU56|A0A087QU56_APTFO) Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 {ECO:0000313|EMBL:KFM04760.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_08510 OC=Aptenodytes.
Sequence
MSSTGNGTDIEEFLVNINLGQYLPNFKEYGYNIVTDCLGINNNVLQQMGVLPTGHRRRIL
KQLDTTLSKMQGNSLFRENLKLKDLKGLEEKQYSSSDQESPISNSSVDGTSLMPATLSEQ
LLNKAYLDKERFELAEQNLLEANDDSFTNLDFSSLYQNSDSILKAINVSGSIKMNTQPDT
SLEEAAAYQADEHLTGCLAFHDPPSSFAHSCETKYSENKHLMFADEDDLSDSEPNSPFFK
FKGEMIDNDLYDSYTQNCMKVFPRASRSFILRHRPVPEIPESSKVQASSRRREGEEREIS
MLPRNLNVSHETFTEEKPPIISPYGETFICGNPKDDKVSFLTCCCDHQDYLLEKTKKTKQ
TPKKKKASVLLPDRKLEELHGNEFLACENKSDLGMNEEYSSSVAPEESESESVYSIVEQR
SLPLKKKKNKDKTHSVSCSKIQSGESDRLVSEQMHLWQSDGDQTSTGNDSITPYACFYGP
SVKKVKAGWLEKLSPQGKRMFQKRWVKFDGDSISYYNNEKEVFSKGIILLSAIATVRVHR
ENKFEVVTSHRTFVFRVDKEEERNDWVNTMLNALKSQSDNNSQSRTSVAPEKSGYLELKG
YKAKIFILLQGNTVWICKNEQDFKTGFGITLIPMNVANVKEVDRTAKQSFEIITPYKSFS
FTAESEREKQDWIEALHQSIAETLSDYEVAEKIWFNESNRSCADCKAPSPDWASINLCVV
ICKKCAGQHRSLGPRDSKVRSLKMDASIWSNELIELFIIIGNKRANSFWAGNLPPDEELH
MDAPAEKRIAFITQKYKEGKFRKAPFPYKTKEQLNKALCAAVVKQDVLETLMLLFSGADA
MCATGDPVYSTPYLLAKKAGQRLQMEFLYHNKFSDFPNYDTCFESGFSEDSSHSTFLCEF
LYKVSSNTAKLLTEKKLKEDCNKRWCTLESGFLSYYENDKTTTPNGMIDINEVICLVMHK
SDFFLNRGDIFTFEIYLMSERVFLFGAETAYSQRKWTWAIAKHFVPPVAECLLERDCDLI
GQLYYKDCHNLDQWRKGWFAIEKSSLYFCLEMENAEEDSIYLRRLQELTISSVMQNGEKI
DVLLLVEKGRTLYIHGHTKLDFMVWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAF
VTQYGLGSKQIYLKNGNSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLCQIDD
ALLTKELYPFWISALDTQNEKERVRKYGAFIRTLPPVNRATLAALIEHLYRVQKCSEINH
MNPHNLAMVFSSCLFQTKGQTSEEVNVIEDLIKNYVQLFDINEDQVKQMDIENSFITRWK
DTQVSQAGDLLIEVYVERKEPDCSIIIRVSPLMEAEELTNDVLGIKNIIPNKDDIWAAFE
VLENGELERPLHYTENVLEQVLHWSSLPEPGTAYLIVKRFLTADMIKLYSEKNEKGSMKA
GNLKYKEEPSKLLSGNKFQERYFVLREGNLLLYKDMKASKPEKVLPVSSLKLYLGVKKKM
KPPTNWGLAVFSEKHQWYICCDGQDALMEWMISIFTAQHADIWPPAGKARKQSITKSPKI
GGLPLIPIQQEKNTCKIRGSTEVKLQSGKQKFGEHHENDFLEERKNLKEKASIVAQCLEQ
KEEKVRNHAKTHRSLISVEDVGAGMTDLHQRPRKALKKNKNKTNKTTLELDNKLPSNVIQ
ELNTVLQKNRALHDE
Download sequence
Identical sequences A0A087QU56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]