SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087RJP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087RJP6
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.13e-68
Family Ankyrin repeat 0.0000456
Further Details:      
 
Domain Number 2 Region: 246-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000058
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 454-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000196
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087RJP6
Sequence length 544
Comment (tr|A0A087RJP6|A0A087RJP6_APTFO) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFM13700.1} KW=Complete proteome; Reference proteome OX=9233 OS=Aptenodytes forsteri (Emperor penguin). GN=AS27_04171 OC=Aptenodytes.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRRLIKQGYSLDVPDNRGWVPIHEAAAHNSSECLR
LLLGAAPSDEYINSKTFEGMCALHLSARHGSLESVRVLLEAGADPNEVTTEATTALFLAV
ENGHADVVKFLLQHGANVKGPHSWSAWNSLHQASFQGCTEIMKILLEKGASKECKDDFGI
TPLFVAAQYGKLESLRLLVSHGADVNCQAKDRATPLLIAAQEGHTECVELLLSKGADPNR
YCNEDNWQLPIHAAAEMGHKKILELLIPITDRICDKGRGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECLNFDCRSPMCMVFQKEFFYFIDIFLKYGIALLGINLGYCLFHEKFTLFR
RFLKLGCSLPSGDQLSEFISYAIKAHEEYKEWLPYLLLAGFDPVNLTRRSWIFSVSENAL
NFILEFTNWKRLPPAVEQDLSDYKEKFTWTPKSHFAFIPSLSHLCRLEIRSILTSERLRS
DRFIRELPLPACLQDYLLYLDVLRVNAIPEAEDYLGQREEGDPSTSHSSTEDAERGDACK
AGVR
Download sequence
Identical sequences A0A087RJP6
XP_009286712.1.47732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]