SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087VZ06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VZ06
Domain Number 1 Region: 283-582
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-75
Family Protein kinases, catalytic subunit 0.000000343
Further Details:      
 
Domain Number 2 Region: 149-278
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-30
Family SH2 domain 0.00011
Further Details:      
 
Domain Number 3 Region: 95-170
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087VZ06
Sequence length 617
Comment (tr|A0A087VZ06|A0A087VZ06_ECHMU) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000132100 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MGNCFTCHDHKENLQCHGDNGMTPMGANSQGGGQGLGQAPFGRHYGPSGDAASVGANQSA
IVPASRGAHQPSQQYSVNLYGMQNGPQQSASYAYSLAQPPATLDQQLAEQSPRVVRVHAL
YTYVAQNADDLSFQKGDVMLVESGLSEAWWLARHLRTGQQGYIPSNYVTVENGLSTQMEA
WYDITRKDAERMLLMPGLPQGTYILRPCSDSRSYALSIRFEIERNMYAIKHYKIRTRDNG
AGFYITNRTNFASVADLISHYQSTSDGLCCRLSQPCPRKYTPPVQFRDIEANRRSLEFIC
ELGNGSFGMVYRARWNKTFDVAVKKRLATTDRALFIEEAKVMHKLHHRRIVRLLGVCTEP
ADEPVFIITELLEKGALRNFLSSEEGRQLFLSDLIDMIAQIAEGMAYLEEMNFVHRDLRA
ANILVDRDNSVKVADFGLAKMLDSDVQNDGVIKFPIKWTAPEAALPDHHFSIKSDVWSFG
VLMYEIVTYGGTPYPRFTNRETVQQVERGYRMPNPNTPTQPCPDDLYDIMMQCWSARPED
RPTFHNLYDIFENWASPQPPPPLQRPRVIVVYPSTRSLRAAFDFINSIHPIPFPSSQLTP
SCRFFDALAFSSLVFFC
Download sequence
Identical sequences A0A087VZ06
EmuJ_000132100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]