SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WUZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WUZ7
Domain Number 1 Region: 371-517
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 573-685
Classification Level Classification E-value
Superfamily PX domain 2.88e-23
Family PX domain 0.0012
Further Details:      
 
Weak hits

Sequence:  A0A087WUZ7
Domain Number - Region: 116-210
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0124
Family Cytochrome c oxidase subunit E 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087WUZ7
Sequence length 888
Comment (tr|A0A087WUZ7|A0A087WUZ7_HUMAN) Sorting nexin-13 {ECO:0000313|Ensembl:ENSP00000479044} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=hCG_2009798 OC=Catarrhini; Hominidae; Homo.
Sequence
MLTEASLSIWGWGSLGIVLFLITFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLE
QCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKIT
EKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGD
FQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNI
GELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTV
KLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVL
LSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPE
IFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPT
GSINLSLDDLSNVSSDDSVQLHAYISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRN
LNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAY
LQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKS
LPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDD
NIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQ
VADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPGE
Download sequence
Identical sequences A0A087WUZ7
ENSP00000386705 ENSP00000479044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]