SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WYJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WYJ0
Domain Number 1 Region: 559-650
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.58e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 413-600
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087WYJ0
Sequence length 746
Comment (tr|A0A087WYJ0|A0A087WYJ0_HUMAN) Small conductance calcium-activated potassium channel protein 3 {ECO:0000313|Ensembl:ENSP00000481848} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCNN3 OC=Catarrhini; Hominidae; Homo.
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQ
PQPPQLQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAIL
HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAT
HNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI
ETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR
VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV
CESPESPAQPSGSSLPAWYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCL
LTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKH
TKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITEL
NDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTT
HTPISDSPIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences A0A087WYJ0
gi|323276683|ref|NP_001191016.1| NP_001191016.1.87134 NP_001191016.1.92137 ENSP00000481848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]