SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WZ11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WZ11
Domain Number 1 Region: 72-118
Classification Level Classification E-value
Superfamily UBA-like 0.000000312
Family UBA domain 0.031
Further Details:      
 
Domain Number 2 Region: 198-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000118
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  A0A087WZ11
Domain Number - Region: 235-317
Classification Level Classification E-value
Superfamily UBC-like 0.00264
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087WZ11
Sequence length 472
Comment (tr|A0A087WZ11|A0A087WZ11_HUMAN) Putative ATP-dependent RNA helicase DHX57 {ECO:0000313|Ensembl:ENSP00000482275} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DHX57 OC=Catarrhini; Hominidae; Homo.
Sequence
MTSENQEKVKALLRDLQEQDADAGSERGLSGEEEDDEPDCCNDERYWPAGQEPSLVPDLD
PLEYAGLASVEPYVPEFTVSPFAVQKLSRYGFNTERCQAVLRMCDGDVGASLEHLLTQCF
SETFGERMKISEAVNQISLDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELEYLT
SRFRKSKPKESTKNVQENSLEICKFYLKGNCKFGSKCRFKHEVPPNQIVGRIERSVDDSH
LNAIEDASFLYELEIRFSKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAE
TSEPVVYSLITLLEEESEIVKLLTNTHHKYSDPPVNFLPVPSRTRINNPACHKTVIPNNS
FVSNQIPEVEKASESEESDEDDGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKIC
KQFRMKQASRQFQSILQERQSLPAWEERETILNLLRKHQVVVISGMTGTYLF
Download sequence
Identical sequences A0A087WZ11
ENSP00000405111 ENSP00000482275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]