SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WZC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WZC4
Domain Number 1 Region: 64-380
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.7e-129
Family Transglutaminase core 0.00000000697
Further Details:      
 
Domain Number 2 Region: 536-634
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.42e-28
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 3 Region: 424-535
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-27
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 
Domain Number 4 Region: 3-62
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000332
Family Transglutaminase N-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087WZC4
Sequence length 637
Comment (tr|A0A087WZC4|A0A087WZC4_HUMAN) Protein-glutamine gamma-glutamyltransferase 5 {ECO:0000313|Ensembl:ENSP00000482542} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TGM5 OC=Catarrhini; Hominidae; Homo.
Sequence
AQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIFVV
ETEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCPWNYGQFEDKIIDICLKLLDKSLH
FQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNGNWSENYTDGANPAEWTGSVAILK
QWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITNFDSGHDTDGNLIIDEYYDNTGR
ILGNKKKDTIWNFHVWNECWMARKDLPPAYGGWQVLDATPQEMSNGVYCCGPASVRAIKE
GEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDTSSVGNFISTKSIQSDERDDITEN
YKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQPSRPTSLSQDSPRSLHTPSLRPSD
VVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQDTA
FITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKILVNKIITLSYPSIT
INVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGSGLFKKQQKVFLGVLKPQHQASII
LETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences A0A087WZC4
ENSP00000482542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]