SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X8B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X8B9
Domain Number 1 Region: 45-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000534
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 108-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000258
Family Fibronectin type I module 0.038
Further Details:      
 
Domain Number 3 Region: 193-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000981
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087X8B9
Sequence length 339
Comment (tr|A0A087X8B9|A0A087X8B9_POEFO) WNT1 inducible signaling pathway protein 3 {ECO:0000313|Ensembl:ENSPFOP00000002022} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MLSLLCCSLVLIFAQQPTSDAQRNGQQLAARGGREPAERRQFCQWPCKCAERTYCAPGVS
SVLDGCGCCKSCARQIGERCNERDVCDPHKGMYCDFSADKPRYEVGVCAYMMAVGCDLNG
VHYENGETFQPSPLYKCTCIGGAIGCTPAFIQKPPGLLGPAPLMSNRPAGLRNGPNPGKH
QQETTYKTAWKKNCLVQTTPWSPCSKTCGLGISVRVNNDNGKCEMRKDRRLCLLRPCEKN
LLKSIKVPKGKTCRPKFQAKKTEKLRLSGCTSTKKFRPTYCGVCKDKRCCVPNKSRMIKV
NFTCKTGSSVQWKMQWISSCVCQKKCTDPGDMFSDLQLL
Download sequence
Identical sequences A0A087X8B9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]