SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XFQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XFQ2
Domain Number 1 Region: 876-1147
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000553
Further Details:      
 
Domain Number 2 Region: 1145-1445
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000116
Further Details:      
 
Domain Number 3 Region: 24-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-37
Family MAM domain 0.00000782
Further Details:      
 
Domain Number 4 Region: 386-590
Classification Level Classification E-value
Superfamily Fibronectin type III 5.65e-27
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 5 Region: 282-423
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000746
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087XFQ2
Sequence length 1448
Comment (tr|A0A087XFQ2|A0A087XFQ2_POEFO) Protein tyrosine phosphatase, receptor type, U, a {ECO:0000313|Ensembl:ENSPFOP00000004605} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MYSAALLLMLAVRICADNLERPTAGCTFDEDSDSGLCEYRQGQEDDFDWQLIKTFNWPNP
TADLLPGSFMMVNSSQHLWGQRAQLYLLPLSENDTHCIQFSYFLYSRDGHSPGALQVFIR
VNGGPKGSAVWNISGSQGRQWHQVELAVSTFWPSDYQVIFEATVSEERQGYIALDDTVLL
NYPCYKVPHFSRLGDVEVNAGQNASFQCVATGKVSETEPFVLERRNSAVLDTSWLSRLSH
KRLMATFQVEAQRGEQDLYRCITLSPRGAAVSNFGELIVRVPPTPIAPPQLLRAGPTYLI
IQLNTNSIVGDGPVIRREIQYRASQSTWKETHVVGSLTYKVWHLEPDTEYYISVLLTRPG
EGGTGAPGPPLVSRTKCAEPMRALRGLTATEIQPRLLALQWEPLGYNLTRCHTYTLYLCY
RYSMPTGSNGGNNATVRECLSVDRNTSRFTLRDLPPFRAVHVRLALANPEGKKESREVTF
QTEEDIPGGIAPESLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSTESSDPGINVPGP
RRTVSKLRNETYHMFSGLHPGTTYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDIPS
PLSESESTITVLLRPALGRGAPVSAYQVVVVEEDGSRRVRRRELGTVDCFPTANSHSEAQ
AKGALHYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLIYFQATSNFKGETR
INCIRIARKAACKDSKRALEVSQHAEDMGLILGACAGGLAVLVLLLGAIVIIVKKGRDFY
SYPYYPRKKVAINKAAMSYRQEKSRKLSPLDCSLTEQSTLQQDERMAHSFMDAHGCNARN
EQRSSVNESSSLLGGSPQRHCRRKSSPYHTGQLHPAVRVADLLQHINQMKTSEGYGFKQE
YESFFDGWDATKKKDKTKGRHDSLLSPDRHRVKLHSLLADPSSDYVNANYIDGYQRSNHF
IATQGPKQEMTYDFWRMVWQENCFSIVMLTKLVEVGRMKCFKYWPEDTELYGDIKITLLK
TETLAEYTVRTFAMERRGYPAKHEVCQFHLTSWPEHGVPYHATGLLAFLRRVKASTPPDA
GPVVVHCSMGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYVFIH
DAILEACLCGETGIPVSEFAPAYKEMLKVDSQSNTSQLREEFQTLNSVTPHLDVEECSVS
LMPRNREKNRSMDVLPPDRSLAFLVTTEGESSNYINAALADSFLRPAAFVVTPHPLPGTT
TDFWRLIYDYSCTSVVMLNQLNQSNSAWPCLQYWPEPGIQQFGPMTVELLSRTADDDVII
RLFRIQNITRLQEGQLVVRHFQFLRWSPYRDVPDSKKAFLSLLAQVHNWQRECGEGRTIV
HCLNGGGRSGTFCACTMILEMIRHHSMVDVFFAAKTLRNSKPNMVETMEQYRFCYELVQE
YLDCLEVR
Download sequence
Identical sequences A0A087XFQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]