SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XKM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XKM2
Domain Number 1 Region: 453-588
Classification Level Classification E-value
Superfamily TIMP-like 8.63e-27
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 406-460
Classification Level Classification E-value
Superfamily BPTI-like 3.83e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 4 Region: 343-401
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000111
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.021
Further Details:      
 
Domain Number 5 Region: 144-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000208
Family Ovomucoid domain III-like 0.037
Further Details:      
 
Domain Number 6 Region: 52-99
Classification Level Classification E-value
Superfamily Elafin-like 0.000000183
Family Elafin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XKM2
Sequence length 590
Comment (tr|A0A087XKM2|A0A087XKM2_POEFO) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 {ECO:0000313|Ensembl:ENSPFOP00000006325} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSEILLQLFQVRHSKDKRWQSKPPFRWTRVFLLVFLICDFLDFSLTASVTGATAEHEGFC
PNKLNNNLWVDAQSTCERECSLDEDCAEHEKCCTNVCGLNSCVSARFSDGTPAQPDGKEG
GGNGDAAPASTATCEGFICSQQGATCDIWDGQPICKCQDRCEKEPYFTCASDGLTYFNRC
YMDAEACIRGVTLTVIPCRFYLAGPHTSPLPLDTTASPTPTSSQEDPMPPTLYSNPHHQS
IYVGGTVSFHCDVIGVPRPDVTWEKQSERRERLVMRPDQMYGNVVITNIGQLVVYNAQVW
DTGIYTCIARNSVGVLQADYPLSVIRRADDEFSEDPELPMGRPFSPADCLAEVDTRVCSG
ERHVDWYYDSKLGSCVTFSSGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCKNW
EARWAWNSLMKQCQPFAYGGCQGNANSFATKKECEANCPQPKRKPCRTCRMRGKMMPTLC
RSDFAIVGRLTELIEDLDSGLAHFSLDEVLRDEKMGLTFFNTKNLEVTIVKIDWSCPCPN
ITMEENPLLVMGMVQDGMAIIQPDSYVKAIPERRLRRLRDAINKNTCETL
Download sequence
Identical sequences A0A087XKM2
ENSPFOP00000006325 XP_007543344.1.10163 XP_014884994.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]