SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087Y1E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y1E8
Domain Number 1 Region: 539-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000107
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 56-102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000122
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 118-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 495-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000291
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087Y1E8
Sequence length 586
Comment (tr|A0A087Y1E8|A0A087Y1E8_POEFO) Complement component 8, beta polypeptide {ECO:0000313|Ensembl:ENSPFOP00000011851} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
LRHSVKPTIVSNLCLLTLTLSLVLLSEFPRTTASDENSSVRETRSVGNRVVVQPLDCVLS
EWSPWSRCDTCAKKKYRYAKLERPSQFGGEPCYLHGTQEERCEVPARYTCDNVPLCEGFL
CTQTGRCIHRTLQCNGEDDCGDMSDEVGCTKTSKPCRVEAEEYWGIENLAKGINVLNSHL
EGVVLDNRYYGGGCLPHYIQDVPFRKPFNLQQYTLQTRGSYDFTLQSFESYSDYMDHTLR
ERMTQTSFSIGFGIPGVFSFGFNYDSSKYSKSVSKIRRASGVTNSFIRAKAELELAQYIL
KSDGLVLHPEFLQRLRSLPQAYVYGEYRQIYKDYGTHYITEAALGGDFEHTTILNKEKLE
KSDYNLDQYKSCLQVGFKIGVTIYGVPVSLGAGGGSCAGLLNEMGEDTKNGAMVEDFVAV
VRGGNSESITALLSQKLPSEQLMRLWGEGVRYNPDFIRMTTKPLYELVTSRDFVQADSLK
RNLKRALSEYLAETSACRCAPCHNNGVAVLKGTRCECVCPTGYTGRSCEITSRLKELGID
GGWSCWGAWSPCSGGQMTRSRQCSNPAPSSGGLPCRGLQQESTDCF
Download sequence
Identical sequences A0A087Y1E8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]