SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YIH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YIH9
Domain Number 1 Region: 376-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-40
Family SPRY domain 0.0017
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-19
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 140-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000143
Family B-box zinc-binding domain 0.00061
Further Details:      
 
Weak hits

Sequence:  A0A087YIH9
Domain Number - Region: 194-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0167
Family FCH domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087YIH9
Sequence length 543
Comment (tr|A0A087YIH9|A0A087YIH9_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000017832} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MEERGVQMDKISCSICLDLLKDPVTIPCGHSYCMNCINDHWDGEDQRRNYSCPQCQKEFT
PRPVLEKNITLDVLVEDLKKTELQAAPADHCYAGPEDVACDVCTGRKRKAVKSCLSCPAS
YCEDHLQHHYDAPPLKRHKLVDPSKTLQDNICSRHNEDEVMKIFCRTDQQCICYLCTMDE
HKGHETVPAAAERAEKQKKLLESRQQIHQRIQDQEKDVKLLQQEVEAINVSADKAVEDSE
KIFTELIRLLQERSSEVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTE
DHTQFLLNYPSLPALRESTKYSSINIRPLRHFEDVTAAVSELRDKLQDVLRDTWTNIELT
VTDVDVLLSEPEPKNRDEFLKYSQELTLDPNTADRVLLLSEENRKATVVLNPEQFRLYNP
SLGTFCFQVLSKESLTGRCYWEVEWGGSAFRVAVSLKNFGNVRQVNESVFGSNSNSWALR
CDEKSYIFIHNDVRTPVPGPVSSRIGVYLDHRAGVLCFYSVSGTMTLLHRVQTRFTQPLY
AGV
Download sequence
Identical sequences A0A087YIH9
ENSPFOP00000017832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]