SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YQI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YQI7
Domain Number 1 Region: 381-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-19
Family RING finger domain, C3HC4 0.0023
Further Details:      
 
Domain Number 3 Region: 136-195
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000519
Family B-box zinc-binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087YQI7
Sequence length 571
Comment (tr|A0A087YQI7|A0A087YQI7_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000020290} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MASACSILYEEQVLCSICLSEFKEPVSTPCGHNFCKGCITQYWNSQDSRPAQCPLCKKKL
GNKPKLQVNSEFRDVVEHFNHTRLKTGPKIVAQPGEVPCDICTEPKLKAHKTCLVCLASY
CKPHLESHQNLKKHKLIDPVSNLEDRVCKKHDKMLELFCRTDQKCVCIMCLNDDHTGHEA
VPLECGFKDRRGMYENVTLDMKKTENSKSQSVKKLKDSVQKSRKISVNDIGQIAEVLAAL
VLSLQKKQDELVRAIKQKQIESEKQTEGRITLLEQHLSDLRKRRSEIEQLIKSEDYLYLL
QNCPSNFTSANATLLDPLTEQHTYAGLVKQSVGQIKKSINREIDMLIQKISSSDCCGAEN
MRPSTPNVWRPPKDKLMMIQQCNAVDVTLNSYSAHPYVIVSADGKTLSYRPTEHFFTPLG
WRFRHYYAVLGNEGFSSGRFYYEVEVNLNRSWTLGVVKESINRDELFPFTPEHGVWVFLG
SLCPPNIRRIGVFVDYERGEVSFYNTETRDLLHSIAGCCFTETKTGLQAFLYSVVGLSTV
HRPKLHPFFLLSGFLSDSLTITPVECTSQDA
Download sequence
Identical sequences A0A087YQI7
ENSPFOP00000020290 XP_007564532.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]