SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088E1T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088E1T5
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Prefoldin 1.15e-23
Family Prefoldin 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088E1T5
Sequence length 128
Comment (tr|A0A088E1T5|A0A088E1T5_9CREN) GimC subunit beta {ECO:0000256|HAMAP-Rule:MF_00307} KW=Complete proteome OX=43687 OS=Metallosphaera sedula. GN=HA72_0082 OC=Metallosphaera.
Sequence
MAERIPPELQTQLLKLQQLQSQLERLTYEKSVIEGELREVNEVLKELANIPQDSPVYKIV
GNLLIKQDRNNVQNELNERKELLELKSRTYQKQEGLLRKQFEDLQKKVNELIQKYYPQGA
PGASPPKA
Download sequence
Identical sequences A0A088E1T5 A4YCV7
WP_011921228.1.15515 WP_011921228.1.27320 WP_011921228.1.28583 WP_011921228.1.31166 WP_011921228.1.34633 WP_011921228.1.8883 WP_011921228.1.99084 gi|146302867|ref|YP_001190183.1| 399549.Msed_0082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]