SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088E5M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088E5M7
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Prefoldin 8.37e-17
Family Prefoldin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088E5M7
Sequence length 144
Comment (tr|A0A088E5M7|A0A088E5M7_9CREN) GimC subunit alpha {ECO:0000256|HAMAP-Rule:MF_00308} KW=Complete proteome OX=43687 OS=Metallosphaera sedula. GN=HA72_1630 OC=Metallosphaera.
Sequence
MAESNNRMVVSLEDLLAQADALRKEIDALQKLRDEIAESLNAARSAKEAINLIKGQGKDL
LLSADRRGFVLLKVTEIPSSKVLVNLGLGYYAEIEPDQASKILDEREEQLNKSLQDITAR
LNNAVNAYTQIAEILNRAQQQQGE
Download sequence
Identical sequences A0A088E5M7 A4YH83
gi|146304393|ref|YP_001191709.1| WP_012021572.1.15515 WP_012021572.1.27320 WP_012021572.1.28583 WP_012021572.1.31166 WP_012021572.1.34633 WP_012021572.1.8883 WP_012021572.1.99084 399549.Msed_1630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]