SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088E735 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088E735
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-32
Family Translational machinery components 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088E735
Sequence length 137
Comment (tr|A0A088E735|A0A088E735_9CREN) 30S ribosomal protein S9 {ECO:0000256|HAMAP-Rule:MF_00532, ECO:0000256|RuleBase:RU003817} KW=Complete proteome OX=43687 OS=Metallosphaera sedula. GN=HA72_2142 OC=Metallosphaera.
Sequence
MSTESRVIITNSRRKMARAKCYLFPGKGRIFVNDVPIELIPVEVIRMKIMEPMLLAGEGI
TSKVDVKIYTYGGGIMGQADAARMALARALVRFTGSQELKELYKKYDRTMMAGDPRQTEA
EKWMRYSARRWRQKSYR
Download sequence
Identical sequences A0A088E735 A4YIM9
gi|146304889|ref|YP_001192205.1| 399549.Msed_2142 WP_012022068.1.15515 WP_012022068.1.27320 WP_012022068.1.28583 WP_012022068.1.31166 WP_012022068.1.34633 WP_012022068.1.8883 WP_012022068.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]