SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090LNR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090LNR8
Domain Number 1 Region: 90-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000104
Family Motor proteins 0.018
Further Details:      
 
Domain Number 2 Region: 7-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090LNR8
Sequence length 224
Comment (tr|A0A090LNR8|A0A090LNR8_STRRB) Dimerization-anchoring domain of cAMP-dependent protein kinase, regulatory subunit and Myosin-like IQ motif-containing domain and P-loop containing nucleoside triphosphate hydrolase domain-containing... {ECO:0000313|EMBL:CEF71406.1} KW=Complete proteome; Reference proteome OX=34506 OS=Strongyloides ratti (Parasitic roundworm). GN=SRAE_X000073200 OC=Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides.
Sequence
MTEQLSDKYKIPETLRPLLEALARETIRAQPTDVVSFGKLFFDILSLHQQDSDKSILTDN
ISYDMFRMDLQHRYKNMTMKENMIRSASPEDVAATKIQAAFRGHQVRMHPEKYGVDAELI
RRRSSDKLASLDFKKDQKRHSIGGYSLEHSQTPEDRAATKIQAEFRGYITRKNIQAMREQ
NDNAATKIQAHVRGFLTRKRLGKEGLISPSRSHSSLQSHKSEEI
Download sequence
Identical sequences A0A090LNR8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]